PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2618s0068.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 356aa    MW: 41070.4 Da    PI: 9.6257
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2618s0068.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-192580156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t++q+++Le++F+++++p+  +r++L ++l+L+ +q+k+WFqN+R++ k
  Bostr.2618s0068.1.p 25 KKNYHRHTNHQIQRLEAYFKECPHPDDLQRRQLGEELNLKPKQIKFWFQNKRTQAK 80
                         688999***********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-18781IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-191076IPR009057Homeodomain-like
PROSITE profilePS5007116.5032282IPR001356Homeobox domain
SMARTSM003891.4E-172486IPR001356Homeobox domain
PfamPF000463.2E-172580IPR001356Homeobox domain
CDDcd000861.13E-152583No hitNo description
PROSITE profilePS5084815.684230355IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDSSRDDSSS DERGTSMDTN NNQDKKNYHR HTNHQIQRLE AYFKECPHPD DLQRRQLGEE  60
LNLKPKQIKF WFQNKRTQAK SHSEKTDNAA LRAENMKMRR ENEAMEDALK NVVCPPCGGR  120
GFGREEKLRN LQKLRAENDF LKREYERLSS FLAQHRGHSI PSVDALPYRH GPSTYGSTSN  180
NRRARYGTSS NHLPQPSSSL RGRYARENIN ITPPPQPEKP LLLQHFPPLS QIEKMVMFET  240
AAKAVAEVMT LIEMEESMWK KSSIDGRLVI DPASYEKCFT KINHFKGSSG RPESSKEVAV  300
VQMDARILVD MFLDTEKWAR LFPTIVNEAK TIYALDSMDR GRQTFSRVAY YINIW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286655.10.0hypothetical protein CARUB_v10002574mg
SwissprotQ9FFI01e-176HDG9_ARATH; Homeobox-leucine zipper protein HDG9
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT5G17320.11e-174(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17320.11e-163homeodomain GLABROUS 9